Ключевое слово
22 | 04 | 2019
Новости Библиотеки
Welcome, Guest
Username: Password: Remember me

TOPIC: Пикотехнология изображения белков

Пикотехнология изображения белков 07 Янв 2012 10:03 #1

  • kushelev
  • kushelev's Avatar
  • OFFLINE
  • Думный дьяк
  • Posts: 266
  • Karma: 0
Пикотехнология белков, ДНК, РНК nanoworld.org.ru/post/8580/#p8580

Это сообщение параллельно обсуждается на форуме molbiol.ru/forums/index.php?showtopic=496777&st=0molbiol.ru

Кушелев: В лаборатории Наномир создана коммерческая версия пикософта, которая может выдавать клиентам структуры белков в стандарте PDB и в дополнительном стандарте PIKO 3D лаборатории Наномир, т.е. в виде файлов, которые можно открывать в программе 3DS Max.







В качестве примера приведена пикотехнологическая модель инсулина.

Файл в стандарте PDB, OCINSAA.ent :


PFRMAT TS
TARGET T00xx
AUTHOR 4236-1297-6301
REMARK Predictor remarks. See DEMO:
REMARK www.nanoworld.org.ru/data/01/data/images/slides/990709/demo.htm
REMARK
REMARK Target sequence (56 acids)
REMARK REVEELQVGQAELGGGPGAGGLQPSALYLALQKRGIVEQCCTSICSLYQLENYCN*
REMARK
METHOD Method description
METHOD The strong correlation dependence of spatial structure
METHOD of the protein from its nucleotide sequence was
METHOD theoretically predicted by physical modelling,
METHOD experimentally discovered and statistically confirmed.
METHOD In the process of biosynthesis the third nucleotide of
METHOD the codon controls the orientation of the amino acid
METHOD forming the concrete spatial isomer that is the
METHOD conformation of the protein molecule cutting off
METHOD competition ways of the forming of 2D and 3D structures.
METHOD On this base the computer program Pikotechnology for
METHOD the prediction of 2D structure of the protins on their
METHOD nucleotide sequence was created.
MODEL 1
PARENT N/A 1
ATOM 1 N ARG A 1 -13.10 12.29 7.33 1.00 0.50 A
ATOM 2 CA ARG A 1 -13.52 11.19 6.90 1.00 0.50 A
ATOM 3 C ARG A 1 -13.50 11.02 5.96 1.00 0.50 A
ATOM 4 O ARG A 1 -12.85 10.99 5.39 1.00 0.50 A
ATOM 5 CB ARG A 1 -12.46 11.38 7.22 1.00 0.50 A
ATOM 6 CG ARG A 1 -11.98 10.87 7.92 1.00 0.50 A
ATOM 7 CD ARG A 1 -12.44 10.03 8.43 1.00 0.50 A
ATOM 8 NE ARG A 1 -13.49 9.69 8.11 1.00 0.50 A
ATOM 9 CZ ARG A 1 -13.21 8.65 7.74 1.00 0.50 A
ATOM 10 NH1 ARG A 1 -12.57 8.16 7.59 1.00 0.50 A
ATOM 11 NH2 ARG A 1 -14.39 8.74 7.61 1.00 0.50 A
ATOM 12 N GLU A 2 -14.89 11.00 5.30 1.00 0.50 A
ATOM 13 CA GLU A 2 -13.69 11.13 5.64 1.00 0.50 A
ATOM 14 C GLU A 2 -13.01 11.01 4.99 1.00 0.50 A
ATOM 15 O GLU A 2 -12.84 11.41 4.24 1.00 0.50 A
ATOM 16 CB GLU A 2 -14.35 11.97 5.27 1.00 0.50 A
ATOM 17 CG GLU A 2 -14.37 12.72 6.03 1.00 0.50 A
ATOM 18 CD GLU A 2 -13.98 13.54 5.34 1.00 0.50 A
ATOM 19 OE1 GLU A 2 -13.74 13.68 4.57 1.00 0.50 A
ATOM 20 OE2 GLU A 2 -14.10 14.07 6.35 1.00 0.50 A
ATOM 21 N VAL A 3 -12.19 9.72 5.19 1.00 0.50 A
ATOM 22 CA VAL A 3 -12.84 10.71 4.79 1.00 0.50 A
ATOM 23 C VAL A 3 -12.56 11.17 4.01 1.00 0.50 A
ATOM 24 O VAL A 3 -12.46 10.92 3.19 1.00 0.50 A
ATOM 25 CB VAL A 3 -13.06 9.64 4.49 1.00 0.50 A
ATOM 26 CG1 VAL A 3 -14.06 9.41 4.75 1.00 0.50 A
ATOM 27 CG2 VAL A 3 -12.87 9.52 3.40 1.00 0.50 A
ATOM 28 N GLU A 4 -11.97 12.56 4.28 1.00 0.50 A
ATOM 29 CA GLU A 4 -12.27 11.41 3.90 1.00 0.50 A
ATOM 30 C GLU A 4 -12.23 11.20 2.97 1.00 0.50 A
ATOM 31 O GLU A 4 -11.57 11.22 2.41 1.00 0.50 A
ATOM 32 CB GLU A 4 -11.23 11.72 4.22 1.00 0.50 A
ATOM 33 CG GLU A 4 -10.94 11.09 5.02 1.00 0.50 A
ATOM 34 CD GLU A 4 -10.00 10.73 4.48 1.00 0.50 A
ATOM 35 OE1 GLU A 4 -9.57 10.81 3.79 1.00 0.50 A
ATOM 36 OE2 GLU A 4 -9.99 10.16 5.48 1.00 0.50 A
ATOM 37 N GLU A 5 -13.64 11.03 2.28 1.00 0.50 A
ATOM 38 CA GLU A 5 -12.69 10.59 2.98 1.00 0.50 A
ATOM 39 C GLU A 5 -11.91 10.28 2.55 1.00 0.50 A
ATOM 40 O GLU A 5 -11.34 10.66 2.03 1.00 0.50 A
ATOM 41 CB GLU A 5 -12.82 11.68 2.68 1.00 0.50 A
ATOM 42 CG GLU A 5 -12.86 12.26 3.57 1.00 0.50 A
ATOM 43 CD GLU A 5 -11.98 12.92 3.26 1.00 0.50 A
ATOM 44 OE1 GLU A 5 -11.43 13.04 2.67 1.00 0.50 A
ATOM 45 OE2 GLU A 5 -12.28 13.31 4.30 1.00 0.50 A
ATOM 46 N LEU A 6 -11.73 8.75 2.63 1.00 0.50 A
ATOM 47 CA LEU A 6 -11.79 9.97 2.34 1.00 0.50 A
ATOM 48 C LEU A 6 -11.10 10.36 1.83 1.00 0.50 A
ATOM 49 O LEU A 6 -10.79 10.19 1.04 1.00 0.50 A
ATOM 50 CB LEU A 6 -12.23 9.14 1.72 1.00 0.50 A
ATOM 51 CG LEU A 6 -13.28 9.32 1.59 1.00 0.50 A
ATOM 52 CD1 LEU A 6 -13.90 8.50 2.04 1.00 0.50 A
ATOM 53 CD2 LEU A 6 -13.48 9.43 0.49 1.00 0.50 A
ATOM 54 N GLN A 7 -10.20 11.32 2.63 1.00 0.50 A
ATOM 55 CA GLN A 7 -10.72 10.47 1.88 1.00 0.50 A
ATOM 56 C GLN A 7 -10.41 10.38 0.98 1.00 0.50 A
ATOM 57 O GLN A 7 -9.63 10.19 0.66 1.00 0.50 A
ATOM 58 CB GLN A 7 -9.84 10.27 2.56 1.00 0.50 A
ATOM 59 CG GLN A 7 -10.11 9.48 3.21 1.00 0.50 A
ATOM 60 CD GLN A 7 -9.23 8.82 2.90 1.00 0.50 A
ATOM 61 OE1 GLN A 7 -8.58 8.80 2.41 1.00 0.50 A
ATOM 62 NE2 GLN A 7 -9.80 8.18 3.67 1.00 0.50 A
ATOM 63 N VAL A 8 -11.40 10.89 -0.08 1.00 0.50 A
ATOM 64 CA VAL A 8 -10.43 10.58 0.64 1.00 0.50 A
ATOM 65 C VAL A 8 -9.62 10.29 0.24 1.00 0.50 A
ATOM 66 O VAL A 8 -9.08 10.67 -0.32 1.00 0.50 A
ATOM 67 CB VAL A 8 -10.63 11.62 0.26 1.00 0.50 A
ATOM 68 CG1 VAL A 8 -10.71 12.28 1.09 1.00 0.50 A
ATOM 69 CG2 VAL A 8 -9.82 11.93 -0.44 1.00 0.50 A
ATOM 70 N GLY A 9 -9.32 8.79 0.43 1.00 0.50 A
ATOM 71 CA GLY A 9 -9.48 9.97 0.05 1.00 0.50 A
ATOM 72 C GLY A 9 -8.81 10.38 -0.49 1.00 0.50 A
ATOM 73 O GLY A 9 -8.49 10.17 -1.27 1.00 0.50 A
ATOM 74 N GLN A 10 -7.99 11.46 0.23 1.00 0.50 A
ATOM 75 CA GLN A 10 -8.45 10.52 -0.45 1.00 0.50 A
ATOM 76 C GLN A 10 -8.12 10.39 -1.34 1.00 0.50 A
ATOM 77 O GLN A 10 -7.33 10.23 -1.65 1.00 0.50 A
ATOM 78 CB GLN A 10 -7.56 10.44 0.24 1.00 0.50 A
ATOM 79 CG GLN A 10 -7.77 9.68 0.95 1.00 0.50 A
ATOM 80 CD GLN A 10 -6.84 9.07 0.68 1.00 0.50 A
ATOM 81 OE1 GLN A 10 -6.19 9.06 0.20 1.00 0.50 A
ATOM 82 NE2 GLN A 10 -7.36 8.45 1.50 1.00 0.50 A
ATOM 83 N ALA A 11 -9.15 10.73 -2.43 1.00 0.50 A
ATOM 84 CA ALA A 11 -8.16 10.56 -1.69 1.00 0.50 A
ATOM 85 C ALA A 11 -7.33 10.30 -2.07 1.00 0.50 A
ATOM 86 O ALA A 11 -6.82 10.68 -2.66 1.00 0.50 A
ATOM 87 CB ALA A 11 -8.44 11.55 -2.15 1.00 0.50 A
ATOM 88 N GLU A 12 -6.92 8.85 -1.77 1.00 0.50 A
ATOM 89 CA GLU A 12 -7.16 9.98 -2.24 1.00 0.50 A
ATOM 90 C GLU A 12 -6.53 10.40 -2.81 1.00 0.50 A
ATOM 91 O GLU A 12 -6.20 10.16 -3.57 1.00 0.50 A
ATOM 92 CB GLU A 12 -7.47 9.01 -2.73 1.00 0.50 A
ATOM 93 CG GLU A 12 -8.53 9.02 -2.85 1.00 0.50 A
ATOM 94 CD GLU A 12 -8.48 8.87 -3.98 1.00 0.50 A
ATOM 95 OE1 GLU A 12 -7.96 8.77 -4.60 1.00 0.50 A
ATOM 96 OE2 GLU A 12 -9.60 8.95 -3.75 1.00 0.50 A
ATOM 97 N LEU A 13 -5.80 11.59 -2.18 1.00 0.50 A
ATOM 98 CA LEU A 13 -6.18 10.57 -2.79 1.00 0.50 A
ATOM 99 C LEU A 13 -5.84 10.39 -3.66 1.00 0.50 A
ATOM 100 O LEU A 13 -5.04 10.27 -3.96 1.00 0.50 A
ATOM 101 CB LEU A 13 -5.29 10.61 -2.09 1.00 0.50 A
ATOM 102 CG LEU A 13 -5.41 9.88 -1.32 1.00 0.50 A
ATOM 103 CD1 LEU A 13 -5.47 10.36 -0.31 1.00 0.50 A
ATOM 104 CD2 LEU A 13 -4.57 9.15 -1.38 1.00 0.50 A
ATOM 105 N GLY A 14 -6.89 10.58 -4.78 1.00 0.50 A
ATOM 106 CA GLY A 14 -5.89 10.53 -4.02 1.00 0.50 A
ATOM 107 C GLY A 14 -5.04 10.31 -4.39 1.00 0.50 A
ATOM 108 O GLY A 14 -4.55 10.69 -5.00 1.00 0.50 A
ATOM 109 N GLY A 15 -4.52 8.92 -3.98 1.00 0.50 A
ATOM 110 CA GLY A 15 -4.85 10.00 -4.53 1.00 0.50 A
ATOM 111 C GLY A 15 -4.25 10.41 -5.13 1.00 0.50 A
ATOM 112 O GLY A 15 -3.89 10.15 -5.87 1.00 0.50 A
ATOM 113 N GLY A 16 -3.61 11.71 -4.59 1.00 0.50 A
ATOM 114 CA GLY A 16 -3.91 10.61 -5.12 1.00 0.50 A
ATOM 115 C GLY A 16 -3.56 10.40 -5.98 1.00 0.50 A
ATOM 116 O GLY A 16 -2.75 10.32 -6.27 1.00 0.50 A
ATOM 117 N PRO A 17 -4.63 10.43 -7.13 1.00 0.50 A
ATOM 118 CA PRO A 17 -4.07 9.86 -6.17 1.00 0.50 A
ATOM 119 C PRO A 17 -3.23 9.44 -6.30 1.00 0.50 A
ATOM 120 O PRO A 17 -2.47 9.73 -6.57 1.00 0.50 A
ATOM 121 CB PRO A 17 -3.93 10.95 -6.44 1.00 0.50 A
ATOM 122 CG PRO A 17 -4.69 11.15 -7.36 1.00 0.50 A
ATOM 123 CD PRO A 17 -5.29 10.27 -7.63 1.00 0.50 A
ATOM 124 N GLY A 18 -3.30 7.86 -6.25 1.00 0.50 A
ATOM 125 CA GLY A 18 -3.25 8.98 -5.69 1.00 0.50 A
ATOM 126 C GLY A 18 -2.42 9.42 -5.61 1.00 0.50 A
ATOM 127 O GLY A 18 -1.85 9.70 -6.20 1.00 0.50 A
ATOM 128 N ALA A 19 -1.86 9.47 -4.18 1.00 0.50 A
ATOM 129 CA ALA A 19 -2.09 9.39 -5.41 1.00 0.50 A
ATOM 130 C ALA A 19 -1.47 9.79 -6.02 1.00 0.50 A
ATOM 131 O ALA A 19 -0.63 9.65 -6.16 1.00 0.50 A
ATOM 132 CB ALA A 19 -1.51 8.62 -4.81 1.00 0.50 A
ATOM 133 N GLY A 20 -2.01 11.05 -6.72 1.00 0.50 A
ATOM 134 CA GLY A 20 -1.37 10.15 -6.14 1.00 0.50 A
ATOM 135 C GLY A 20 -0.47 9.98 -6.39 1.00 0.50 A
ATOM 136 O GLY A 20 0.24 10.48 -6.39 1.00 0.50 A
ATOM 137 N GLY A 21 -0.26 8.62 -7.17 1.00 0.50 A
ATOM 138 CA GLY A 21 -0.41 9.27 -6.11 1.00 0.50 A
ATOM 139 C GLY A 21 0.34 9.73 -5.74 1.00 0.50 A
ATOM 140 O GLY A 21 0.85 10.35 -6.04 1.00 0.50 A
ATOM 141 N LEU A 22 0.87 9.09 -4.44 1.00 0.50 A
ATOM 142 CA LEU A 22 0.67 9.64 -5.54 1.00 0.50 A
ATOM 143 C LEU A 22 1.21 10.38 -5.80 1.00 0.50 A
ATOM 144 O LEU A 22 2.06 10.47 -5.92 1.00 0.50 A
ATOM 145 CB LEU A 22 1.37 8.77 -5.38 1.00 0.50 A
ATOM 146 CG LEU A 22 1.07 7.96 -6.02 1.00 0.50 A
ATOM 147 CD1 LEU A 22 0.77 7.06 -5.44 1.00 0.50 A
ATOM 148 CD2 LEU A 22 1.93 7.74 -6.71 1.00 0.50 A
ATOM 149 N GLN A 23 0.46 11.73 -5.80 1.00 0.50 A
ATOM 150 CA GLN A 23 1.25 10.76 -5.71 1.00 0.50 A
ATOM 151 C GLN A 23 2.16 10.89 -5.93 1.00 0.50 A
ATOM 152 O GLN A 23 2.77 11.41 -5.60 1.00 0.50 A
ATOM 153 CB GLN A 23 1.01 11.47 -4.86 1.00 0.50 A
ATOM 154 CG GLN A 23 0.63 10.90 -4.05 1.00 0.50 A
ATOM 155 CD GLN A 23 1.43 11.27 -3.32 1.00 0.50 A
ATOM 156 OE1 GLN A 23 2.07 11.76 -3.26 1.00 0.50 A
ATOM 157 NE2 GLN A 23 0.80 10.53 -2.70 1.00 0.50 A
ATOM 158 N PRO A 24 2.60 10.19 -7.27 1.00 0.50 A
ATOM 159 CA PRO A 24 2.34 10.15 -6.05 1.00 0.50 A
ATOM 160 C PRO A 24 3.00 10.45 -5.43 1.00 0.50 A
ATOM 161 O PRO A 24 3.39 11.20 -5.31 1.00 0.50 A
ATOM 162 CB PRO A 24 2.11 11.03 -6.72 1.00 0.50 A
ATOM 163 CG PRO A 24 2.42 10.67 -7.84 1.00 0.50 A
ATOM 164 CD PRO A 24 2.78 9.63 -7.87 1.00 0.50 A
ATOM 165 N SER A 25 3.63 9.31 -4.60 1.00 0.50 A
ATOM 166 CA SER A 25 3.34 10.32 -5.28 1.00 0.50 A
ATOM 167 C SER A 25 3.74 11.15 -5.06 1.00 0.50 A
ATOM 168 O SER A 25 4.56 11.41 -5.04 1.00 0.50 A
ATOM 169 CB SER A 25 4.18 9.60 -5.53 1.00 0.50 A
ATOM 170 OG SER A 25 5.16 10.10 -5.44 1.00 0.50 A
ATOM 171 N ALA A 26 2.77 12.17 -4.43 1.00 0.50 A
ATOM 172 CA ALA A 26 3.71 11.43 -4.78 1.00 0.50 A
ATOM 173 C ALA A 26 4.60 11.78 -4.82 1.00 0.50 A
ATOM 174 O ALA A 26 5.10 12.14 -4.21 1.00 0.50 A
ATOM 175 CB ALA A 26 3.35 11.55 -3.72 1.00 0.50 A
ATOM 176 N LEU A 27 5.16 12.12 -6.21 1.00 0.50 A
ATOM 177 CA LEU A 27 4.56 11.13 -6.69 1.00 0.50 A
ATOM 178 C LEU A 27 5.03 10.30 -6.78 1.00 0.50 A
ATOM 179 O LEU A 27 5.42 9.79 -6.20 1.00 0.50 A
ATOM 180 CB LEU A 27 4.58 11.40 -5.59 1.00 0.50 A
ATOM 181 CG LEU A 27 3.57 11.51 -5.25 1.00 0.50 A
ATOM 182 CD1 LEU A 27 3.37 12.55 -4.89 1.00 0.50 A
ATOM 183 CD2 LEU A 27 3.39 10.75 -4.44 1.00 0.50 A
ATOM 184 N TYR A 28 5.51 9.92 -8.19 1.00 0.50 A
ATOM 185 CA TYR A 28 4.48 10.43 -8.68 1.00 0.50 A
ATOM 186 C TYR A 28 3.73 9.87 -8.86 1.00 0.50 A
ATOM 187 O TYR A 28 3.24 9.37 -8.35 1.00 0.50 A
ATOM 188 CB TYR A 28 4.69 10.35 -7.57 1.00 0.50 A
ATOM 189 CD2 TYR A 28 4.76 11.20 -6.80 1.00 0.50 A
ATOM 190 CE2 TYR A 28 4.77 11.80 -6.29 1.00 0.50 A
ATOM 191 CZ TYR A 28 4.57 12.55 -6.59 1.00 0.50 A
ATOM 192 CE1 TYR A 28 4.39 12.64 -7.33 1.00 0.50 A
ATOM 193 CD1 TYR A 28 4.38 12.01 -7.80 1.00 0.50 A
ATOM 194 CG TYR A 28 4.61 11.29 -7.49 1.00 0.50 A
ATOM 195 OH TYR A 28 4.74 12.78 -5.61 1.00 0.50 A
ATOM 196 N LEU A 29 3.47 9.64 -10.36 1.00 0.50 A
ATOM 197 CA LEU A 29 3.63 9.60 -9.12 1.00 0.50 A
ATOM 198 C LEU A 29 3.01 9.10 -8.59 1.00 0.50 A
ATOM 199 O LEU A 29 2.79 8.26 -8.59 1.00 0.50 A
ATOM 200 CB LEU A 29 4.10 8.87 -9.85 1.00 0.50 A
ATOM 201 CG LEU A 29 5.16 8.88 -9.72 1.00 0.50 A
ATOM 202 CD1 LEU A 29 5.68 9.23 -10.65 1.00 0.50 A
ATOM 203 CD2 LEU A 29 5.49 7.86 -9.42 1.00 0.50 A
ATOM 204 N ALA A 30 2.08 9.97 -7.73 1.00 0.50 A
ATOM 205 CA ALA A 30 2.64 9.13 -8.47 1.00 0.50 A
ATOM 206 C ALA A 30 2.42 8.21 -8.37 1.00 0.50 A
ATOM 207 O ALA A 30 1.68 7.77 -8.45 1.00 0.50 A
ATOM 208 CB ALA A 30 1.68 9.67 -8.73 1.00 0.50 A
ATOM 209 N LEU A 31 3.55 7.36 -7.75 1.00 0.50 A
ATOM 210 CA LEU A 31 2.49 7.91 -8.12 1.00 0.50 A
ATOM 211 C LEU A 31 1.72 7.38 -8.27 1.00 0.50 A
ATOM 212 O LEU A 31 1.26 6.86 -7.76 1.00 0.50 A
ATOM 213 CB LEU A 31 2.79 7.76 -7.04 1.00 0.50 A
ATOM 214 CG LEU A 31 2.80 8.70 -6.54 1.00 0.50 A
ATOM 215 CD1 LEU A 31 3.83 8.95 -6.16 1.00 0.50 A
ATOM 216 CD2 LEU A 31 2.05 8.67 -5.71 1.00 0.50 A
ATOM 217 N GLN A 32 1.33 7.26 -9.76 1.00 0.50 A
ATOM 218 CA GLN A 32 1.58 7.13 -8.54 1.00 0.50 A
ATOM 219 C GLN A 32 1.01 6.60 -8.00 1.00 0.50 A
ATOM 220 O GLN A 32 0.77 5.77 -8.04 1.00 0.50 A
ATOM 221 CB GLN A 32 1.98 6.44 -9.35 1.00 0.50 A
ATOM 222 CG GLN A 32 3.04 6.46 -9.30 1.00 0.50 A
ATOM 223 CD GLN A 32 3.12 5.33 -9.16 1.00 0.50 A
ATOM 224 OE1 GLN A 32 2.68 4.65 -9.11 1.00 0.50 A
ATOM 225 NE2 GLN A 32 4.21 5.70 -9.13 1.00 0.50 A
ATOM 226 N LYS A 33 0.14 7.45 -6.99 1.00 0.50 A
ATOM 227 CA LYS A 33 1.21 6.90 -7.32 1.00 0.50 A
ATOM 228 C LYS A 33 1.30 5.96 -7.20 1.00 0.50 A
ATOM 229 O LYS A 33 0.86 5.29 -7.52 1.00 0.50 A
ATOM 230 CB LYS A 33 0.33 7.05 -8.01 1.00 0.50 A
ATOM 231 CG LYS A 33 0.39 7.58 -8.86 1.00 0.50 A
ATOM 232 CD LYS A 33 1.29 7.96 -9.26 1.00 0.50 A
ATOM 233 CE LYS A 33 2.29 7.87 -8.84 1.00 0.50 A
ATOM 234 NZ LYS A 33 2.56 7.46 -7.94 1.00 0.50 A
ATOM 235 N ARG A 34 2.29 5.55 -6.04 1.00 0.50 A
ATOM 236 CA ARG A 34 2.07 5.93 -7.21 1.00 0.50 A
ATOM 237 C ARG A 34 1.80 5.29 -7.87 1.00 0.50 A
ATOM 238 O ARG A 34 1.13 4.75 -7.91 1.00 0.50 A
ATOM 239 CB ARG A 34 1.29 5.90 -6.39 1.00 0.50 A
ATOM 240 CG ARG A 34 0.76 6.68 -6.09 1.00 0.50 A
ATOM 241 CD ARG A 34 0.86 7.65 -6.56 1.00 0.50 A
ATOM 242 NE ARG A 34 1.55 7.76 -7.47 1.00 0.50 A
ATOM 243 CZ ARG A 34 0.76 8.05 -8.24 1.00 0.50 A
ATOM 244 NH1 ARG A 34 -0.05 8.12 -8.35 1.00 0.50 A
ATOM 245 NH2 ARG A 34 1.81 8.08 -8.81 1.00 0.50 A
ATOM 246 N GLY A 35 2.92 4.98 -8.94 1.00 0.50 A
ATOM 247 CA GLY A 35 1.99 5.69 -8.49 1.00 0.50 A
ATOM 248 C GLY A 35 1.09 5.44 -8.64 1.00 0.50 A
ATOM 249 O GLY A 35 0.64 4.74 -8.44 1.00 0.50 A
ATOM 250 N ILE A 36 0.33 6.38 -9.67 1.00 0.50 A
ATOM 251 CA ILE A 36 0.77 6.13 -8.52 1.00 0.50 A
ATOM 252 C ILE A 36 0.28 5.54 -7.95 1.00 0.50 A
ATOM 253 O ILE A 36 0.05 4.72 -8.04 1.00 0.50 A
ATOM 254 CB ILE A 36 1.04 5.54 -9.45 1.00 0.50 A
ATOM 255 CG1 ILE A 36 2.10 5.55 -9.57 1.00 0.50 A
ATOM 256 CG2 ILE A 36 2.59 6.06 -8.69 1.00 0.50 A
ATOM 257 CD1 ILE A 36 0.65 4.49 -9.39 1.00 0.50 A
ATOM 258 N VAL A 37 -0.40 6.25 -6.77 1.00 0.50 A
ATOM 259 CA VAL A 37 -0.05 5.55 -7.74 1.00 0.50 A
ATOM 260 C VAL A 37 -0.26 4.62 -7.75 1.00 0.50 A
ATOM 261 O VAL A 37 -1.02 4.20 -7.72 1.00 0.50 A
ATOM 262 CB VAL A 37 -1.03 6.11 -7.68 1.00 0.50 A
ATOM 263 CG1 VAL A 37 -1.09 6.77 -8.51 1.00 0.50 A
ATOM 264 CG2 VAL A 37 -1.88 5.39 -7.65 1.00 0.50 A
ATOM 265 N GLU A 38 0.95 3.70 -7.56 1.00 0.50 A
ATOM 266 CA GLU A 38 -0.15 4.29 -7.57 1.00 0.50 A
ATOM 267 C GLU A 38 -0.95 3.78 -7.62 1.00 0.50 A
ATOM 268 O GLU A 38 -1.29 3.18 -7.11 1.00 0.50 A
ATOM 269 CB GLU A 38 0.39 3.96 -6.63 1.00 0.50 A
ATOM 270 CG GLU A 38 0.55 4.82 -6.03 1.00 0.50 A
ATOM 271 CD GLU A 38 -0.01 4.39 -5.13 1.00 0.50 A
ATOM 272 OE1 GLU A 38 -0.41 3.73 -4.87 1.00 0.50 A
ATOM 273 OE2 GLU A 38 0.31 5.43 -4.78 1.00 0.50 A
ATOM 274 N GLN A 39 -1.69 3.90 -9.02 1.00 0.50 A
ATOM 275 CA GLN A 39 -1.41 4.34 -7.88 1.00 0.50 A
ATOM 276 C GLN A 39 -1.86 4.00 -7.12 1.00 0.50 A
ATOM 277 O GLN A 39 -1.93 3.20 -6.79 1.00 0.50 A
ATOM 278 CB GLN A 39 -0.88 3.47 -8.37 1.00 0.50 A
ATOM 279 CG GLN A 39 0.15 3.70 -8.43 1.00 0.50 A
ATOM 280 CD GLN A 39 0.47 2.77 -7.85 1.00 0.50 A
ATOM 281 OE1 GLN A 39 0.18 2.11 -7.47 1.00 0.50 A
ATOM 282 NE2 GLN A 39 1.46 3.32 -8.07 1.00 0.50 A
ATOM 283 N CYS A 40 -2.97 4.88 -6.52 1.00 0.50 A
ATOM 284 CA CYS A 40 -2.30 5.91 -6.78 1.00 0.50 A
ATOM 285 C CYS A 40 -1.74 6.28 -6.11 1.00 0.50 A
ATOM 286 O CYS A 40 -1.07 5.95 -5.67 1.00 0.50 A
ATOM 287 CB CYS A 40 -1.95 4.84 -6.96 1.00 0.50 A
ATOM 288 SG CYS A 40 -2.85 4.12 -6.68 1.00 0.50 A
ATOM 289 N CYS A 41 -2.24 7.62 -5.55 1.00 0.50 A
ATOM 290 CA CYS A 41 -1.78 6.48 -5.78 1.00 0.50 A
ATOM 291 C CYS A 41 -0.99 6.20 -5.33 1.00 0.50 A
ATOM 292 O CYS A 41 -0.80 6.11 -4.49 1.00 0.50 A
ATOM 293 CB CYS A 41 -2.55 6.71 -4.98 1.00 0.50 A
ATOM 294 SG CYS A 41 -2.84 7.86 -5.08 1.00 0.50 A
ATOM 295 N THR A 42 0.25 6.12 -6.24 1.00 0.50 A
ATOM 296 CA THR A 42 -0.60 6.28 -5.34 1.00 0.50 A
ATOM 297 C THR A 42 -0.37 6.08 -4.44 1.00 0.50 A
ATOM 298 O THR A 42 0.24 6.39 -3.91 1.00 0.50 A
ATOM 299 CB THR A 42 0.11 7.08 -5.69 1.00 0.50 A
ATOM 300 OG1 THR A 42 -0.45 7.92 -6.02 1.00 0.50 A
ATOM 301 CG2 THR A 42 0.82 7.34 -4.87 1.00 0.50 A
ATOM 302 N SER A 43 -1.06 4.82 -3.88 1.00 0.50 A
ATOM 303 CA SER A 43 -0.31 5.76 -4.21 1.00 0.50 A
ATOM 304 C SER A 43 0.29 6.13 -3.57 1.00 0.50 A
ATOM 305 O SER A 43 0.93 5.78 -3.11 1.00 0.50 A
ATOM 306 CB SER A 43 -0.05 4.67 -4.32 1.00 0.50 A
ATOM 307 OG SER A 43 0.80 4.40 -3.66 1.00 0.50 A
ATOM 308 N ILE A 44 -0.11 7.57 -3.08 1.00 0.50 A
ATOM 309 CA ILE A 44 0.41 6.80 -3.92 1.00 0.50 A
ATOM 310 C ILE A 44 1.28 6.47 -3.76 1.00 0.50 A
ATOM 311 O ILE A 44 1.62 5.99 -3.12 1.00 0.50 A
ATOM 312 CB ILE A 44 -0.23 6.47 -3.05 1.00 0.50 A
ATOM 313 CG1 ILE A 44 -1.06 5.90 -3.42 1.00 0.50 A
ATOM 314 CG2 ILE A 44 -0.96 5.76 -4.55 1.00 0.50 A
ATOM 315 CD1 ILE A 44 0.36 5.86 -2.32 1.00 0.50 A
ATOM 316 N CYS A 45 2.38 7.08 -4.71 1.00 0.50 A
ATOM 317 CA CYS A 45 1.45 6.27 -4.48 1.00 0.50 A
ATOM 318 C CYS A 45 1.63 5.48 -3.99 1.00 0.50 A
ATOM 319 O CYS A 45 1.93 5.35 -3.19 1.00 0.50 A
ATOM 320 CB CYS A 45 1.73 7.15 -3.82 1.00 0.50 A
ATOM 321 SG CYS A 45 2.60 7.75 -4.36 1.00 0.50 A
ATOM 322 N SER A 46 1.58 4.20 -4.83 1.00 0.50 A
ATOM 323 CA SER A 46 1.81 5.14 -4.04 1.00 0.50 A
ATOM 324 C SER A 46 2.06 4.94 -3.15 1.00 0.50 A
ATOM 325 O SER A 46 2.73 4.50 -2.82 1.00 0.50 A
ATOM 326 CB SER A 46 2.58 4.66 -4.72 1.00 0.50 A
ATOM 327 OG SER A 46 3.36 4.14 -4.12 1.00 0.50 A
ATOM 328 N LEU A 47 0.98 5.27 -2.11 1.00 0.50 A
ATOM 329 CA LEU A 47 1.89 4.81 -2.82 1.00 0.50 A
ATOM 330 C LEU A 47 2.65 4.40 -2.40 1.00 0.50 A
ATOM 331 O LEU A 47 2.72 3.73 -1.87 1.00 0.50 A
ATOM 332 CB LEU A 47 0.98 4.23 -2.48 1.00 0.50 A
ATOM 333 CG LEU A 47 0.47 3.85 -3.35 1.00 0.50 A
ATOM 334 CD1 LEU A 47 -0.56 4.26 -3.43 1.00 0.50 A
ATOM 335 CD2 LEU A 47 0.47 2.73 -3.28 1.00 0.50 A
ATOM 336 N TYR A 48 3.97 5.26 -2.52 1.00 0.50 A
ATOM 337 CA TYR A 48 3.13 4.46 -2.99 1.00 0.50 A
ATOM 338 C TYR A 48 3.17 3.54 -2.75 1.00 0.50 A
ATOM 339 O TYR A 48 3.11 3.14 -1.98 1.00 0.50 A
ATOM 340 CB TYR A 48 2.99 5.05 -2.04 1.00 0.50 A
ATOM 341 CD2 TYR A 48 2.15 5.80 -1.80 1.00 0.50 A
ATOM 342 CE2 TYR A 48 1.56 6.29 -1.65 1.00 0.50 A
ATOM 343 CZ TYR A 48 0.96 6.34 -2.23 1.00 0.50 A
ATOM 344 CE1 TYR A 48 1.00 5.94 -2.88 1.00 0.50 A
ATOM 345 CD1 TYR A 48 1.62 5.45 -2.98 1.00 0.50 A
ATOM 346 CG TYR A 48 2.20 5.44 -2.41 1.00 0.50 A
ATOM 347 OH TYR A 48 0.59 6.99 -1.53 1.00 0.50 A
ATOM 348 N GLN A 49 3.66 2.59 -3.91 1.00 0.50 A
ATOM 349 CA GLN A 49 2.77 3.26 -3.34 1.00 0.50 A
ATOM 350 C GLN A 49 2.33 2.90 -2.57 1.00 0.50 A
ATOM 351 O GLN A 49 2.63 2.65 -1.80 1.00 0.50 A
ATOM 352 CB GLN A 49 3.87 3.32 -3.09 1.00 0.50 A
ATOM 353 CG GLN A 49 4.18 4.33 -3.22 1.00 0.50 A
ATOM 354 CD GLN A 49 4.56 4.43 -2.15 1.00 0.50 A
ATOM 355 OE1 GLN A 49 4.65 4.02 -1.45 1.00 0.50 A
ATOM 356 NE2 GLN A 49 4.75 5.46 -2.61 1.00 0.50 A
ATOM 357 N LEU A 50 0.87 2.50 -2.83 1.00 0.50 A
ATOM 358 CA LEU A 50 2.07 2.63 -2.49 1.00 0.50 A
ATOM 359 C LEU A 50 2.33 2.41 -1.60 1.00 0.50 A
ATOM 360 O LEU A 50 2.28 1.68 -1.15 1.00 0.50 A
ATOM 361 CB LEU A 50 1.63 1.69 -2.94 1.00 0.50 A
ATOM 362 CG LEU A 50 2.17 1.44 -3.83 1.00 0.50 A
ATOM 363 CD1 LEU A 50 1.52 1.47 -4.74 1.00 0.50 A
ATOM 364 CD2 LEU A 50 2.63 0.43 -3.68 1.00 0.50 A
ATOM 365 N GLU A 51 2.69 3.63 -0.74 1.00 0.50 A
ATOM 366 CA GLU A 51 2.29 2.56 -1.24 1.00 0.50 A
ATOM 367 C GLU A 51 2.34 1.76 -0.73 1.00 0.50 A
ATOM 368 O GLU A 51 1.99 1.54 0.03 1.00 0.50 A
ATOM 369 CB GLU A 51 1.64 3.28 -0.67 1.00 0.50 A
ATOM 370 CG GLU A 51 0.84 3.57 -1.30 1.00 0.50 A
ATOM 371 CD GLU A 51 0.03 3.22 -0.57 1.00 0.50 A
ATOM 372 OE1 GLU A 51 -0.08 2.88 0.16 1.00 0.50 A
ATOM 373 OE2 GLU A 51 -0.56 3.62 -1.48 1.00 0.50 A
ATOM 374 N ASN A 52 3.43 0.74 -1.22 1.00 0.50 A
ATOM 375 CA ASN A 52 2.30 1.26 -1.31 1.00 0.50 A
ATOM 376 C ASN A 52 1.61 0.98 -0.71 1.00 0.50 A
ATOM 377 O ASN A 52 1.55 0.98 0.15 1.00 0.50 A
ATOM 378 CB ASN A 52 3.14 1.66 -0.67 1.00 0.50 A
ATOM 379 CG ASN A 52 4.04 0.84 -1.03 1.00 0.50 A
ATOM 380 OD1 ASN A 52 4.09 0.20 -1.57 1.00 0.50 A
ATOM 381 ND2 ASN A 52 4.49 1.51 -0.32 1.00 0.50 A
ATOM 382 N TYR A 53 0.48 0.12 -1.41 1.00 0.50 A
ATOM 383 CA TYR A 53 1.01 1.22 -1.13 1.00 0.50 A
ATOM 384 C TYR A 53 0.87 1.60 -0.27 1.00 0.50 A
ATOM 385 O TYR A 53 1.04 1.31 0.53 1.00 0.50 A
ATOM 386 CB TYR A 53 1.50 0.21 -0.96 1.00 0.50 A
ATOM 387 CD2 TYR A 53 2.49 -0.17 -1.40 1.00 0.50 A
ATOM 388 CE2 TYR A 53 3.18 -0.40 -1.69 1.00 0.50 A
ATOM 389 CZ TYR A 53 3.61 0.17 -2.12 1.00 0.50 A
ATOM 390 CE1 TYR A 53 3.34 0.88 -2.23 1.00 0.50 A
ATOM 391 CD1 TYR A 53 2.64 1.06 -1.91 1.00 0.50 A
ATOM 392 CG TYR A 53 2.23 0.48 -1.52 1.00 0.50 A
ATOM 393 OH TYR A 53 4.26 -0.62 -2.17 1.00 0.50 A
ATOM 394 N CYS A 54 -0.06 2.88 -0.28 1.00 0.50 A
ATOM 395 CA CYS A 54 1.05 2.32 -0.44 1.00 0.50 A
ATOM 396 C CYS A 54 1.59 2.13 0.31 1.00 0.50 A
ATOM 397 O CYS A 54 1.46 1.64 1.01 1.00 0.50 A
ATOM 398 CB CYS A 54 0.08 1.77 -0.30 1.00 0.50 A
ATOM 399 SG CYS A 54 -0.79 2.58 -0.26 1.00 0.50 A
ATOM 400 N ASN A 55 2.87 3.04 0.44 1.00 0.50 A
ATOM 401 CA ASN A 55 2.26 2.06 -0.05 1.00 0.50 A
ATOM 402 C ASN A 55 2.20 1.26 0.45 1.00 0.50 A
ATOM 403 O ASN A 55 1.85 1.08 1.22 1.00 0.50 A
ATOM 404 CB ASN A 55 1.78 2.88 0.57 1.00 0.50 A
ATOM 405 CG ASN A 55 2.80 3.62 0.70 1.00 0.50 A
ATOM 406 OD1 ASN A 55 3.59 3.60 0.44 1.00 0.50 A
ATOM 407 ND2 ASN A 55 1.98 4.11 1.21 1.00 0.50 A
TER
END

Так же доступны: вторичная структура в стандарте SS:

PFRMAT SS
TARGET T00xx
AUTHOR 4236-1297-6301
REMARK Predictor remarks. See DEMO:
REMARK www.nanoworld.org.ru/data/01/data/images/slides/990709/demo.htm
REMARK
METHOD Method description
METHOD The strong correlation dependence of spatial structure
METHOD of the protein from its nucleotide sequence was
METHOD theoretically predicted by physical modelling,
METHOD experimentally discovered and statistically confirmed.
METHOD In the process of biosynthesis the third nucleotide of
METHOD the codon controls the orientation of the amino acid
METHOD forming the concrete spatial isomer that is the
METHOD conformation of the protein molecule cutting off
METHOD competition ways of the forming of 2D and 3D structures.
METHOD On this base the computer program Pikotechnology for
METHOD the prediction of 2D structure of the protins on their
METHOD nucleotide sequence was created.
MODEL 1
PARENT N/A 1
R H 1.00
E H 1.00
V H 1.00
E H 1.00
E H 1.00
L H 1.00
Q H 1.00
V H 1.00
G H 1.00
Q H 1.00
A H 1.00
E H 1.00
L H 1.00
G H 1.00
G H 1.00
G H 1.00
P H 1.00
G H 1.00
A H 1.00
G H 1.00
G H 1.00
L H 1.00
Q H 1.00
P H 1.00
S H 1.00
A H 1.00
L E 1.00
Y E 1.00
L H 1.00
A H 1.00
L H 1.00
Q H 1.00
K H 1.00
R H 1.00
G H 1.00
I H 1.00
V H 1.00
E H 1.00
Q H 1.00
C E 1.00
C H 1.00
T H 1.00
S H 1.00
I H 1.00
C H 1.00
S H 1.00
L H 1.00
Y H 1.00
Q H 1.00
L H 1.00
E H 1.00
N H 1.00
Y H 1.00
C H 1.00
N H 1.00
* H 1.00
END


и в стандарте PIKO 2D:



Композиционный код:

1,1,4,1,1,4,1,4,4,1,4,1,4,1,4,1,1,1,4,1,1,4,1,1,4,4,3,3,4,1,4,1,1,1,1,1,4,1,1,3,1,1,1,1,1,4,1,1,1,4,1,1,1,1,1

Входными данными для программы PikoSoft являются стандартные файлы из GenBank:

ID OCINSAA standard; RNA; MAM; 250 BP.
XX
AC M61153;
XX
DT 12-APR-1991 (Rel. 28, Created)
DT 15-APR-1994 (Rel. 39, Last updated, Version 2)
XX
DE Oryctolagus cuniculus insulin mRNA, partial cds.
XX
KW insulin.
XX
OS Oryctolagus cuniculus (rabbit)
OC Eukaryota; Animalia; Metazoa; Chordata; Vertebrata; Mammalia;
OC Theria; Eutheria; Lagomorpha; Leporidae.
XX
RN [1]
RP 1-250
RA Giddings S.J., Carnaghi L., Devaskar S.;
RT Nucleotide sequence of a cDNA encoding rabbit preproinsulin;
RL Unpublished.
XX
CC NCBI gi: 165444
XX
FH Key Location/Qualifiers
FH
FT source 1..250
FT /organism=Oryctolagus cuniculus
FT CDS 1..168
FT /note=NCBI gi: 470321
FT /product=insulin
FT /codon_start=1
XX
SQ Sequence 250 BP; 36 A; 105 C; 78 G; 31 T; 0 other;
cgcgaggtgg aggagctgca ggtggggcag gcggagctgg gcgggggccc cggcgcgggc
ggcctgcagc cctcggcgct ttatctggcc ctgcagaagc gcggcatcgt ggagcagtgt
tgcaccagca tctgctcgct ctaccagctg gagaactact gcaactaggg gtgcccccca
cccacccctg cccgcgcccc ccacgccccc cgccctcgcc cccacccaat aaacccctcc
acgcgccccc
//

Отредактировано mittelspiel (2012-01-11 00:09:48)
Last Edit: 08 Сен 2013 07:55 by Vladimirovich.

Пикотехнология изображения белков 07 Янв 2012 10:06 #2

  • kushelev
  • kushelev's Avatar
  • OFFLINE
  • Думный дьяк
  • Posts: 266
  • Karma: 0

nanoworld88.narod.ru/data/263.htm Построена структура коллагена.


Эта модель сделана с точностью 1 пикометр.




Подробности: nanoworld88.narod.ru/data/268.htm

Как проверить структуру коллагена хотя бы с точностью до нанометра?

Отредактировано kushelev (2012-01-07 14:07:46)
Last Edit: 08 Сен 2013 07:59 by Vladimirovich.

Пикотехнология изображения белков 07 Янв 2012 10:51 #3

Вахххх, форум quantrinas превращается в отстойник научных фриков... и отбросов molbiol-а

Уж не знаю, стоит ли поздравлять с этим администрацию ?

Пикотехнология изображения белков 07 Янв 2012 11:08 #4

  • limarodessa
  • limarodessa's Avatar
  • NOW ONLINE
  • Доцент
  • Posts: 13716
  • Thank you received: 38
  • Karma: 0
kushelev написал(а):
Это сообщение параллельно обсуждается на форуме molbiol.ru
molbiol.ru/forums/index.php?showtopic=496777&st=50#entry1280667

ihlindham написал(а):
А вот и журнал для Вас вполне подходящий:

dnadecipher.com/
Student2012 написал(а):
А как переводится название журнала на русский язык?
Отредактировано limarodessa (2012-01-07 15:31:19)
Страсти - это ветры, надувающие паруса корабля, иногда они его топят, но без них он не мог бы плавать. (Вольтер)
Last Edit: 08 Сен 2013 08:00 by Vladimirovich.

Пикотехнология изображения белков 07 Янв 2012 11:11 #5

  • limarodessa
  • limarodessa's Avatar
  • NOW ONLINE
  • Доцент
  • Posts: 13716
  • Thank you received: 38
  • Karma: 0
kushelev написал(а):
Кушелев: В лаборатории Наномир создана коммерческая версия пикософта, которая может выдавать клиентам структуры
nanoworld.org.ru/topic/26/

Kushelev написал(а):
...Лицензированные версии можно продавать по 100 000 евро...
А если у меня столько денег нет ?
Страсти - это ветры, надувающие паруса корабля, иногда они его топят, но без них он не мог бы плавать. (Вольтер)
Last Edit: 08 Сен 2013 08:00 by Vladimirovich.

Пикотехнология изображения белков 07 Янв 2012 11:12 #6

  • limarodessa
  • limarodessa's Avatar
  • NOW ONLINE
  • Доцент
  • Posts: 13716
  • Thank you received: 38
  • Karma: 0
Диар френд PauLita ! Я там Вам личное сообщение послал... Вы ознакомились ?
Страсти - это ветры, надувающие паруса корабля, иногда они его топят, но без них он не мог бы плавать. (Вольтер)

Пикотехнология изображения белков 07 Янв 2012 11:17 #7

  • limarodessa
  • limarodessa's Avatar
  • NOW ONLINE
  • Доцент
  • Posts: 13716
  • Thank you received: 38
  • Karma: 0
чайник555 написал(а):
Уж не знаю, стоит ли поздравлять с этим администрацию ?
Диар комрад чайник555 ! У нас уже третий новичок менее чем за неделю... Вы не находите ?
Страсти - это ветры, надувающие паруса корабля, иногда они его топят, но без них он не мог бы плавать. (Вольтер)

Пикотехнология изображения белков 07 Янв 2012 11:23 #8

  • limarodessa
  • limarodessa's Avatar
  • NOW ONLINE
  • Доцент
  • Posts: 13716
  • Thank you received: 38
  • Karma: 0
Диар френд чайник555 ! Я там Вам тоже личное сообщение послал...
Страсти - это ветры, надувающие паруса корабля, иногда они его топят, но без них он не мог бы плавать. (Вольтер)

Пикотехнология изображения белков 07 Янв 2012 11:37 #9

limarodessa написал(а):
Диар френд чайник555 ! Я там Вам тоже личное сообщение послал...
Уважаемый Игорь !
А ежели этот новичок нафлудит поболее ППГ (а он, судя по картинкам, может сделать это легко и непринуждённо) кому должна сказать СПАСИБА! уважаемая Инквизиция ?

Пикотехнология изображения белков 07 Янв 2012 11:38 #10

  • limarodessa
  • limarodessa's Avatar
  • NOW ONLINE
  • Доцент
  • Posts: 13716
  • Thank you received: 38
  • Karma: 0
чайник555 написал(а):
судя по картинкам, может сделать это легко и непринуждённо
Эт да
- Петрович (в этой номинации по крайней мере) нервно курит в сторонке
Страсти - это ветры, надувающие паруса корабля, иногда они его топят, но без них он не мог бы плавать. (Вольтер)

Пикотехнология изображения белков 07 Янв 2012 11:39 #11

limarodessa написал(а):
чайник555@ написал(а):
Уж не знаю, стоит ли поздравлять с этим администрацию ?
Диар комрад чайник555 ! У нас уже третий новичок менее чем за неделю... Вы не находите ?
Вот до чего острая интоксикация организма доводит...

Пикотехнология изображения белков 07 Янв 2012 11:43 #12

limarodessa написал(а):
чайник555 написал(а):
судя по картинкам, может сделать это легко и непринуждённо
Эт да  - Петрович (в этой номинации по крайней мере) нервно курит в сторонке
окодэмик не курит, окодэмик отжимается с обнажённым торсом...

Пикотехнология изображения белков 07 Янв 2012 11:44 #13

limarodessa написал(а):
Пожалуй это объяснение... время года вроде бы не то которое провоцирует...
я бы сказал -

Пикотехнология изображения белков 07 Янв 2012 12:33 #14

  • limarodessa
  • limarodessa's Avatar
  • NOW ONLINE
  • Доцент
  • Posts: 13716
  • Thank you received: 38
  • Karma: 0
kushelev написал(а):
Как проверить структуру коллагена хотя бы с точностью до нанометра?
quantoforum.ru/biology/127-bazy-po-prost...strukture-biomolekul Базы по пространственной структуре биомолекул
Страсти - это ветры, надувающие паруса корабля, иногда они его топят, но без них он не мог бы плавать. (Вольтер)
Last Edit: 08 Апр 2015 13:27 by Vladimirovich.

Пикотехнология изображения белков 07 Янв 2012 12:35 #15

  • Автор: Чукча не из Сибири..
  • Автор: Чукча не из Сибири..'s Avatar
Ну зачем же так... ППГ нам тут может и продемонстрировать свое воблирование на примерах .. модели предложить ... что бы было что то убедительное ...
ps
Эликсир молодости изобретался уже не один раз, но каждый раз изобретатели уносили его секрет с собой в детство.

Пикотехнология изображения белков 07 Янв 2012 12:44 #16

  • limarodessa
  • limarodessa's Avatar
  • NOW ONLINE
  • Доцент
  • Posts: 13716
  • Thank you received: 38
  • Karma: 0
чайник555 написал(а):
...может сделать это легко и непринуждённо...
...без напряжения мышц лица

Страсти - это ветры, надувающие паруса корабля, иногда они его топят, но без них он не мог бы плавать. (Вольтер)

Пикотехнология изображения белков 07 Янв 2012 12:47 #17

  • Vladimirovich
  • Vladimirovich's Avatar
  • OFFLINE
  • Инквизитор
  • Posts: 77741
  • Thank you received: 1028
  • Karma: 81
чайник555 написал(а):
Уж не знаю, стоит ли поздравлять с этим администрацию ?
Администрация стоит на принципах полной свободы научных мнений
Так же как и их критики
Это единственный форум такого рода

Каждому - своё.

Пикотехнология изображения белков 07 Янв 2012 13:01 #18

Vladimirovich написал(а):
Администрация стоит на принципах полной свободы научных мнений
а квази научных ?

Пикотехнология изображения белков 07 Янв 2012 13:05 #19

  • limarodessa
  • limarodessa's Avatar
  • NOW ONLINE
  • Доцент
  • Posts: 13716
  • Thank you received: 38
  • Karma: 0
чайник555 написал(а):
а квази научных ?
А Вы сначала докажите что они КВАЗИ. Для того чтобы это сделать (доказать) нужно потратить не меньше бабла чем для того чтобы доказать справедливость идей Петровича и Ко

Страсти - это ветры, надувающие паруса корабля, иногда они его топят, но без них он не мог бы плавать. (Вольтер)

Пикотехнология изображения белков 07 Янв 2012 13:25 #20

  • Vladimirovich
  • Vladimirovich's Avatar
  • OFFLINE
  • Инквизитор
  • Posts: 77741
  • Thank you received: 1028
  • Karma: 81
чайник555 написал(а):
а квази научных ?
Опровергайте


Каждому - своё.

Пикотехнология изображения белков 07 Янв 2012 15:41 #21

  • kushelev
  • kushelev's Avatar
  • OFFLINE
  • Думный дьяк
  • Posts: 266
  • Karma: 0
limarodessa написал(а):
А если у меня столько денег нет ?
Всё очень просто. Вы заказываете пикотехнологическую модель интересующего Вас белка. Я делаю её для Вас бесплатно. Вы используете её в своей работе, получаете прибыль, и на эти деньги покупаете программу, если она Вам нужна.

Вот пример белка коннексина, который построен с помощью скрипта Кушелева:


Оригинал: img-fotki.yandex.ru/get/4427/126580004.3...12_571c27ed_orig.gif

Скрипт Кушелева:

-- Nanoworld Laboratory. Alexander Kushelev. Peptide pikotechnology
-- nanoworld.narod.ru/
p = #()
angx = #(-24,180,60,-45,-45); angy = #(-10.89167,83,0,15,15); angz = #(92,120,60,110,110)
dx = #(2,1.5,1.6,2,2); dy = #(0.6,1,0.8,1,0.6); dz = #(-0.45,0,-0.6,-0.15,-0.45)
-- Cx26
kk = #(1,3,1,1,4,4,1,4,1,4,4,3,4,1,3,1,1,1,1,3,2,1,1,1,1,1,1,1,1,3
,3,1,3,1,1,1,3,4,3,2,1,1,4,1,2,3,1,1,1,1,3,1,1,1,1,4,1,2,1,1
,1,1,4,1,1,3,1,1,1,1,1,1,1,1,4,2,1,1,4,1,4,1,1,4,1,4,2,4,1,2
,4,1,1,1,4,1,1,4,3,3,1,1,1,1,1,1,1,1,4,1,2,1,3,2,3,1,1,1,1,1
,1,3,1,1,1,1,1,1,3,1,1,4,1,1,1,1,2,1,1,1,1,1,4,1,1,1,3,1,1,1
,1,1,1,1,3,1,1,1,1,1,1,1,1,1,4,4,4,1,1,1,1,1,3,3,1,1,3,4,1,1
,3,4,1,4,1,4,1,1,3,1,1,2,4,1,1,3,2,4,3,2,3,1,1,4,4,3,1,3,3,1
,3,3,1,2,3,3,3,3,3,4,1,2,3,1,2,3)
peptide = box length:1 width:1 height:1 position:[0,0,-.5] wirecolor:[250,250,250]; Converttomesh peptide
for k = 1 to 226 do(
element = Hedra family:1 scalep:100 scaleq:100 scaler:100 radius:1 pos:[0,0,0] p:0.4; Converttomesh element
attach peptide element; peptide.pivot = [0,0,0]; move peptide [dx[kk[k]],dy[kk[k]],dz[kk[k]]]
rotate peptide angx[kk[k]] [1,0,0]; rotate peptide angy[kk[k]] [0,1,0]; rotate peptide angz[kk[k]] [0,0,1])

А это - попытка собрать из 6 субъединиц четвертичную структуру коннексона:





Last Edit: 08 Апр 2015 13:28 by Vladimirovich.

Пикотехнология изображения белков 07 Янв 2012 15:51 #22

  • limarodessa
  • limarodessa's Avatar
  • NOW ONLINE
  • Доцент
  • Posts: 13716
  • Thank you received: 38
  • Karma: 0
kushelev написал(а):
Всё очень просто. Вы заказываете пикотехнологическую модель интересующего Вас белка. Я делаю её для Вас бесплатно. Вы используете её в своей работе, получаете прибыль, и на эти деньги покупаете программу, если она Вам нужна
Прибыль составит 100 тыс. евро необходимые (как написано на Вашем форуме) для покупки программы ?


Отредактировано limarodessa (2012-01-07 19:51:49)
Страсти - это ветры, надувающие паруса корабля, иногда они его топят, но без них он не мог бы плавать. (Вольтер)

Пикотехнология изображения белков 07 Янв 2012 16:02 #23

  • PauLita
  • PauLita's Avatar
  • OFFLINE
  • Боярин
  • Рыцарь Желтого Ведерка
  • Posts: 7026
  • Thank you received: 24
  • Karma: 6
kushelev написал(а):
В качестве примера приведена пикотехнологическая модель инсулина.

limarodessa, не волнуйтесь, можете использовать и бесплатные програмы:


Пожалуйста помогите Алисе, жертве опытов Петра Петровича Гаряева: vk.com/id11904625

Пикотехнология изображения белков 07 Янв 2012 16:14 #24

  • limarodessa
  • limarodessa's Avatar
  • NOW ONLINE
  • Доцент
  • Posts: 13716
  • Thank you received: 38
  • Karma: 0
PauLita написал(а):
limarodessa, не волнуйтесь, можете использовать и бесплатные програмы:
PauLita не мешайте... Что Вы под ногами путаетесь ? Вы что не видите - два ученых мужа дела перетирают ? Помолчали бы когда два джигита разговаривают...
Страсти - это ветры, надувающие паруса корабля, иногда они его топят, но без них он не мог бы плавать. (Вольтер)

Пикотехнология изображения белков 07 Янв 2012 16:16 #25

  • PauLita
  • PauLita's Avatar
  • OFFLINE
  • Боярин
  • Рыцарь Желтого Ведерка
  • Posts: 7026
  • Thank you received: 24
  • Karma: 6
Один, понятно - доцент, ну а второй?
Пожалуйста помогите Алисе, жертве опытов Петра Петровича Гаряева: vk.com/id11904625

Пикотехнология изображения белков 07 Янв 2012 16:17 #26

  • kushelev
  • kushelev's Avatar
  • OFFLINE
  • Думный дьяк
  • Posts: 266
  • Karma: 0
limarodessa написал(а):
Базы по пространственной структуре биомолекул
Там именно этого коллагена нет. Коллаген не кристаллизуется, поэтому РСА для него непригоден...

Пикотехнология изображения белков 07 Янв 2012 16:18 #27

  • limarodessa
  • limarodessa's Avatar
  • NOW ONLINE
  • Доцент
  • Posts: 13716
  • Thank you received: 38
  • Karma: 0
PauLita написал(а):
ну а второй?
Не знаю
Вы же у нас специалист по поиску личных данных в Интернет. Только будьте осторожны - смотрите не повторите прошлой ошибки когда от Вас потребовали компенсацию

Страсти - это ветры, надувающие паруса корабля, иногда они его топят, но без них он не мог бы плавать. (Вольтер)

Пикотехнология изображения белков 07 Янв 2012 16:24 #28

  • kushelev
  • kushelev's Avatar
  • OFFLINE
  • Думный дьяк
  • Posts: 266
  • Karma: 0
limarodessa написал(а):
Прибыль составит 100 тыс. евро необходимые (как написано на Вашем форуме) для покупки программы ?
Если полученная Вам от меня пикотехнологическая модель поможет Вас сделать научное открытие на уровне Нобелевской, то Вы сможете купить и программу. А вообще программа нужна фирмам, которые заказывают большое количество моделей. Допустим, что через некоторое время я начну продавать пикотехнологические модели, скажем, по 3000 евро. Это в три раза дешевле, чем заказать определение структуры белка в лаборатории РСА. При этом пикософт позволяет определять структуры не только 3% белков, способных кристаллизоваться


Если фирма планирует заказать более 30 структур, то ей выгоднее купить программу Пикотех и получить с её помощью хоть 1000 структур белка.

Примеры пикотехнологических моделей можно посмотреть, например, здесь: nanoworld88.narod.ru/data/212.htm
Last Edit: 08 Апр 2015 13:28 by Vladimirovich.

Пикотехнология изображения белков 07 Янв 2012 16:30 #29

  • limarodessa
  • limarodessa's Avatar
  • NOW ONLINE
  • Доцент
  • Posts: 13716
  • Thank you received: 38
  • Karma: 0
kushelev написал(а):
Вы заказываете пикотехнологическую модель интересующего Вас белка. Я делаю её для Вас бесплатно
А зачем мне заказывать у Вас пикотехнологическую модель ? Напомню что изначально мой вопрос звучал:

limarodessa написал(а):
А если у меня столько денег нет ?
который я задал в свою очередь в связи со следующим Вашим утверждением:

kushelev написал(а):
...Лицензированные версии можно продавать по 100 000 евро...
Что пикотехнологическая модель в случае отсутствия денег может поспособствовать их появлению ?

Отредактировано limarodessa (2012-01-07 20:31:58)
Страсти - это ветры, надувающие паруса корабля, иногда они его топят, но без них он не мог бы плавать. (Вольтер)

Пикотехнология изображения белков 07 Янв 2012 16:40 #30

  • limarodessa
  • limarodessa's Avatar
  • NOW ONLINE
  • Доцент
  • Posts: 13716
  • Thank you received: 38
  • Karma: 0
kushelev написал(а):
фирмам, которые заказывают большое количество моделей
kushelev написал(а):
Всё очень просто. Вы заказываете пикотехнологическую модель интересующего Вас белка. Я делаю её для Вас бесплатно
Фирмам Вы тоже модель даете бесплатно ?


Отредактировано limarodessa (2012-01-07 20:41:19)
Страсти - это ветры, надувающие паруса корабля, иногда они его топят, но без них он не мог бы плавать. (Вольтер)
Рейтинг@Mail.ru

Научно-шахматный клуб КвантоФорум