Ключевое слово
24 | 06 | 2019
Новости Библиотеки
Шахматы Онлайн
Welcome, Guest
Username: Password: Remember me

TOPIC: Контексты и комментарии генома

Контексты и комментарии генома 10 Март 2019 08:01 #1

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Дополним Уотсона и Крика... ;)

Контексты и комментарии генома 10 Март 2019 08:47 #2

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Тезис-корректировка вобл-гипотезы.
Трансляция аминокислоты задается первыми двумя нуклиотидами триплета ДНК (мРНК).Третий нуклеотид "воблирует" (вставляется случайным образом) не хаотично,а является "комментарием" трансляции - аналогом контекстной информации (как в программировании комментарий кода при написании).
Логические предпосылки:
...............to be continued
Last Edit: 10 Март 2019 09:38 by hide.

Контексты и комментарии генома 10 Март 2019 12:50 #3

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
СРАВНИТЕЛЬНЫЙ АНАЛИЗ ИНТЕРВАЛЬНЫХ ОЦЕНОК ИЗБЫТОЧНОСТИ СИНОНИМИЧНЫХ КОДОНОВ мРНК ЖИВОТНЫХ И ЧЕЛОВЕКА
Д. Б. Корнев, А. В. Дмитриев
"...С 1980 гг. и по настоящее время, результаты исследований избыточности синонимичных кодонов аминокислотами крайне ограничены. Авторами [2] показано, что родственные организмы имеют сходный тип предпочтения кодонов, т.е. частота использования одного кодона из серии синонимичных больше чем для других...
...Кроме того, многие тРНК способны опознавать не только «свой» кодон, но и некоторые другие. Как правило тРНК, распознающие более одного синонимичного кодона, опознают их с разной эффективностью. Все это также влияет на выбор кодонов...
...в хордовых и артроподах наиболее часто Ala кодируется GCC; Asn – AAC; Asp – GAC; Gln – CAG; Gly – GGA, GGC; His – CAC; Ile – AUC, Leu – CUG; Phe – UUC; Thr – ACC; Tyr – UAC; Val – GUG. Для аминокислот Arg, Cys, Glu, Lys, Pro и Ser частота использования синонимичных кодонов одинакова. Примечательно, что подобная схема выбора кодонов характерна и для человека. Кроме того, артроподы, хордовые и человек для кодирования аминокислот отдают предпочтение кодонам, содержащим G или C (частота 0.5); менее часто – A или U (частота 0.3)..."

Как минимум,уже просматривается первое различие - опознавание с различной эффективностью,а следовательно,регуляторная функция скорости синтеза и экспрессии данного протеина...
Last Edit: 10 Март 2019 15:47 by hide.

Контексты и комментарии генома 15 Март 2019 20:55 #4

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
".. Регуляция синтеза белка
Соматические клетки всех тканей и органов многоклеточного организма содержат одинаковую генетическую информацию, но отличаются друг от друга по содержанию тех или иных белков. Для эритроцитов, например, характерно высокое содержание гемоглобина, для клеток соединительной ткани – коллагена, клетки поджелудочной железы вырабатывают много ферментов. В отдельных клетках, тканях и органах содержание разных белков меняется онтогенез. Все это свидетельствует о том, что в живых организмах существуют механизмы, регулирующие белковый синтез. Они функционируют под действием внутренних и внешних факторов на каждой из стадий сложного процесса синтеза белка. Количество протеинов может изменяться в результате увеличения числа некоторых генов, регуляции на стадии транскрипции, процессинга мРНК. Скорость белкового синтеза определяется также и временем жизни мРНК, регуляцией синтеза на уровне трансляции и посттрансляционной модификации белков.
Регуляция на самых ранних этапах (на уровне экспрессии генов) является наиболее выгодной и поэтому широко встречается у эукариотических организмов. На экспрессию генов у эукариот влияет целый ряд факторов.
Организация хроматина и доступность генов: в ядрах дифференцированных клеток хроматин имеет такую укладку, что только небольшое число генов доступно для транскрипции. Различают участки гетерохроматина, в которых ДНК упакована очень компактно и для транскрипции недоступна, и участки эухроматина, имеющие более рыхлую укладку и способные связывать РНК-полимеразу. В разных типах клеток в область эухроматина попадают разные гены. Это ведет к тому, что в разных тканях транскрибируются разные участки хроматина.
Изменение количества генов: амплификация (увеличение числа) генов при необходимости увеличения синтеза определенного генного продукта; утрата генетического материала (процесс, происходящий при созревании некоторых типов клеток, например, эритроцитов).
Перестройка генов или генетичесая рекомбинация: перемещение генов между хромосомами или внутри одной хромосомы, объединение генов с образованием измененной хромосомы, которая после таких изменений способна к репликации и транскрипции.
Регуляция транскрипции (см. лекцию № 6).
Существенное значение в обеспечении разнообразия белков играет посттранскрипционный процессинг РНК. Основные способы такой регуляции – альтернативный сплайсинг и изменение стабильности РНК.
Известны и некоторые случаи регуляции количества и разнообразия белков путем изменения скорости процесса их трансляции. Наиболее изученный пример – синтез белков в ретикулоцитах. Известно, что на этом уровне дифференцировки кроветворные клетки лишены ядра, а следовательно и ДНК. Регуляция синтеза белка-глобина осуществляется только на уровне трансляции и зависит от содержания гема в клетке..."

Контексты и комментарии генома 15 Март 2019 21:27 #5

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Теория Ф. Жакоба и Ж- Моно о регуляции синтеза и-РНК и белков
www.biovedia.ru/bveds-472-1.html

Контексты и комментарии генома 15 Март 2019 21:32 #6

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
"...Как было указано, концентрация ряда ферментов в клетках резко снижается при повышении содержания отдаленных конечных продуктов, образующихся в цепи последовательных ферментативных реакций. Такой эффект, получивший название репрессии ферментов, часто наблюдается при реакциях биосинтеза. В этих случаях молекулы репрессора, также образующиеся в рибосомах ядра по «команде» гена-регулятора, являются неактивными и сами по себе не обладают способностью подавлять деятельность гена-оператора и, следовательно, всего оперона, но приобретают такую способность после образования комплекса с конечным или одним из конечных продуктов биосинтетического процесса (см. рис. 14.13).
Конечный продукт выступает, таким образом, в качестве корепрессора. Имеются данные, что в качестве корепрессоров в синтезе ферментов обмена аминокислот, по-видимому, выступает не только свободная аминокислота как конечный продукт биосинтетической реакции, но и комплекс ее с тРНК – аминоацил-тРНК..."
Last Edit: 15 Март 2019 21:33 by hide.

Контексты и комментарии генома 15 Март 2019 21:45 #7

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Следует указать еще на один момент, почему эукариотическая клетка использует положительные механизмы регуляции экспрессии генов. Подсчитано, что в геноме человека содержится около 100000 генов, соответственно каждая клетка при отрицательном механизме регуляции могла бы синтезировать 100000 разных репрессоров, причем в достаточных количествах. При положительном механизме регуляции большинство генов в принципе неактивно, соответственно молекула РНК-полимеразы не связывается с промотором и клетка синтезирует ограниченный и избирательный круг активаторных белков, необходимых для инициации транскрипции.
У эукариот выделены и охарактеризованы также пять регуляторных белков, получивших название транскрипционных факторов (TF: IIА, IIВ, IID, IIЕ и IIF). Они необходимы для узнавания участка (сайта) ДНК, названного TATA (concensus последовательности, ТАТАААА). Детальный молекулярный механизм действия факторов транскрипции пока не раскрыт.
Следует отметить, однако, что некоторые из них или почти все регуляторные белки активируют транскрипцию не прямо, а опосредованно – через промежуточные белки, названные коактиваторами. Происхождение и механизм действия последних также не выяснены.
Last Edit: 15 Март 2019 21:48 by hide.

Контексты и комментарии генома 16 Март 2019 11:33 #8

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Похоже,все управление интенсивностью синтеза пептидов происходит при помощи белков-посредников.Значит,внешнее управление будет ориентировано на их активацию/деактивацию... :?

Syn.png
Last Edit: 16 Март 2019 11:36 by hide.

Контексты и комментарии генома 22 Март 2019 23:37 #9

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
"...О механизмах регулирования, а тем более
взаимного регулирования этих процессов известно еще очень мало.
В регуляции белкового синтеза принимают участие различные факто-
ры, механизмы ее также весьма разнообразны (см., например, [2]).
Самые общие представления имеются в настоящее время о регуляции
внутриклеточного протеолиза [3]. Вместе с тем возможность функцио-
нальной взаимосвязи этих метаболических путей в согласованной ре-
гуляции при изменении условий существования клетки весьма реальна,
и поиск факторов, принимающих участие и в том, и в другом процессе,
может пролить свет на механизмы взаиморегуляции.
Удобной моделью в этом случае является аминокислотное голода-
ние клеток. Известно, что клетки отвечают на недостаток питательных
веществ самыми разнообразными компенсаторными либо адаптацион-
ными проявлениями. Несмотря на то, что в высших организмах в от-
личие от прокариот специализация тканей и гормональная регуляция
делают ненужными многие из таких прямых ответных реакций, клетки
млекопитающих сохраняют способность непосредственного ответа на
аминокислотное голодание. Этот ответ проявляется в снижении уров-
ня синтеза транспортных и рибосомных РНК
[4, 5], в согласованной
регуляции ферментов синтеза аминокислот [6], а также в уменьшении
уровня биосинтеза белков и ускорении их внутриклеточной деградации..."
Б. С. Негруцкий
ТРАНСПОРТНАЯ РНК
КАК ФАКТОР РЕГУЛЯЦИИ БЕЛКОВОГО ГОМЕОСТАЗА

Интересно,каких именно тРНК? :? Ведь, по факту, существует спектр специфических и универсальных изоакцепторных тРНК...
Last Edit: 23 Март 2019 07:59 by hide.

Контексты и комментарии генома 23 Март 2019 08:26 #10

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Строгий ответ
Это реакция клеток на аминокислотное голодание, приводящая к значительному замедлению синтеза стабильных РНК (рРНК и тРНК) и некоторых мРНК, необходимых для синтеза рибосомных белков, факторов элонгации EF-Ts, EF-Tu и EF-G, α-субъединицы РНК-полимеразы, а также к усилению транскрипции оперонов биосинтеза аминокислот. Общий синтез РНК снижается в итоге до 5-10% от нормального. Возрастает скорость деградации белка, уменьшается синтез нуклеотидов, липидов и углеводов.

Строгая регуляция осуществляется несколькими генами, наиболее изученным из которых является ген relA. Этот ген отвечает за синтез двух специфических нуклеотидов, накапливающихся при аминокислотном голодании гуанозинтетрафосфата (ppGpp) и гуанозинпентафосфата (pppGpp). Эти нуклеотиды и являются ингибиторами синтеза специфических типов РНК. Сигналом образования ppGpp служит не непосредственно отсутствие какой-либо аминокислоты, а недостаток аминоацил-тРНК. Белок RelA в ассоциации с рибосомами синтезирует (p)ppGpp только когда в А-сайте рибосомы оказывается ненагруженная аминикислотой тРНК.
www.zinref.ru/000_uchebniki/04600_raznie_2/705/006.htm
Last Edit: 23 Март 2019 11:14 by Хайдук.

Контексты и комментарии генома 23 Март 2019 09:08 #11

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Genomic tRNA database
This genomic tRNA database contains tRNA gene predictions made by the program tRNAscan-SE (Lowe & Eddy, Nucl Acids Res 25: 955-964, 1997) on complete or nearly complete genomes.
lowelab.ucsc.edu/GtRNAdb/
ru.vlab.wikia.com/wiki/%D0%A2%D0%A0%D0%9D%D0%9A

DATABASES ON MEDICINE AND MOLECULAR BIOLOGY
www.meddb.info/index.php?cat=8&subcat=26
Last Edit: 23 Март 2019 10:17 by hide.

Контексты и комментарии генома 23 Март 2019 12:58 #12

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Итерация_3:
В данный конкретный момент времени,после процесса редактирования, пул кодировки данной АК на мРНК содержит набор идентичных кодонов из синонимичного множества для данной АК... :flag:

Screenshot_2019-03-23.png
Last Edit: 23 Март 2019 13:02 by hide.

Контексты и комментарии генома 23 Март 2019 13:01 #13

  • nonlocality
  • nonlocality's Avatar
  • OFFLINE
  • Петрович
  • Posts: 6992
  • Thank you received: 14
  • Karma: -14
Не противно объедки с барского стола подбирать? :lol:

Контексты и комментарии генома 24 Март 2019 13:41 #14

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Представляется очень вероятным,что третий нуклеотид кодонов белка определяет степень его экспрессии. PSL - нуклеотид (PeptideSynthesisLevel)
Уровень синтеза пептидов должен кореллировать с уровнем связи нуклеотидов А-Т(U) и С-G...

Контексты и комментарии генома 24 Март 2019 14:51 #15

  • Vladimirovich
  • Vladimirovich's Avatar
  • OFFLINE
  • Инквизитор
  • Posts: 78946
  • Thank you received: 1077
  • Karma: 81
Все ухнуто в quantoforum.ru/nobelprize/2942-volnovoj-...ovichem-o-tripletakh
Ибо автор хотел :)
Каждому - своё.

Контексты и комментарии генома 24 Март 2019 15:07 #16

  • Хайдук
  • Хайдук's Avatar
  • OFFLINE
  • Наместник
  • Posts: 37037
  • Thank you received: 85
  • Karma: 22
а почему не 1му и/или 2му нуклеотидам не рулить PSL ? :idea:

Контексты и комментарии генома 24 Март 2019 15:58 #17

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Хайдук wrote:
а почему не 1му и/или 2му нуклеотидам не рулить PSL ? :idea:
Потому...Главное - чтобы хоть кто-то рулил... ;)

Контексты и комментарии генома 24 Март 2019 16:02 #18

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Подтверждением о PSL-нуклеотиде может быть то, что кодировка АМ, содержащая только ДВА кодона, использует разновесные, по силе связи, пары А-Т(U) и С-G...
Last Edit: 24 Март 2019 17:34 by hide.

Контексты и комментарии генома 24 Март 2019 16:45 #19

  • Хайдук
  • Хайдук's Avatar
  • OFFLINE
  • Наместник
  • Posts: 37037
  • Thank you received: 85
  • Karma: 22
какая пара сильнее? :xren:

ЗЫ. после запятой "," жми на пробел, чтоб лучше читалось и дабы не прослыл неграмотеем :lol:
Last Edit: 24 Март 2019 16:52 by Хайдук.

Контексты и комментарии генома 24 Март 2019 17:31 #20

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
C - G...

Контексты и комментарии генома 24 Март 2019 17:34 #21

  • Хайдук
  • Хайдук's Avatar
  • OFFLINE
  • Наместник
  • Posts: 37037
  • Thank you received: 85
  • Karma: 22
заметил, что эти две пары зажигают существенно у антикодонов тРНК (о чём Петрович врядли подозревает, конечно...) :yess:
Last Edit: 24 Март 2019 17:36 by Хайдук.

Контексты и комментарии генома 24 Март 2019 17:43 #22

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
C_G вообще привалируют в геноме...Почему? :? :lol:
quantoforum.ru/biology/3147-biosintez-ad...-regulyatsiya#455620
Last Edit: 24 Март 2019 17:52 by hide.

Контексты и комментарии генома 24 Март 2019 18:19 #23

  • Хайдук
  • Хайдук's Avatar
  • OFFLINE
  • Наместник
  • Posts: 37037
  • Thank you received: 85
  • Karma: 22
хз :idea:

Контексты и комментарии генома 26 Март 2019 08:58 #24

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Еще один факт...Частота включения аминокислот в состав белка кореллирует с числом кодонов-синонимов для данной АК... :unsure: :?
Last Edit: 26 Март 2019 09:00 by hide.

Контексты и комментарии генома 26 Март 2019 11:48 #25

  • Хайдук
  • Хайдук's Avatar
  • OFFLINE
  • Наместник
  • Posts: 37037
  • Thank you received: 85
  • Karma: 22
браво, умница! :clapping: хотя это далеко ... не обязательно :lol:

Контексты и комментарии генома 26 Март 2019 12:53 #26

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Возможно, это справедливо для всех тканей (коих гистологически определяется около 210 штук)...Но, для тканеспецифичных белков, вероятно, это не так... :flag:

frec.png
Last Edit: 26 Март 2019 13:03 by hide.

Контексты и комментарии генома 26 Март 2019 13:05 #27

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Возьмем, к примеру, инсулин...
51 АК-остаток

Warning: Spoiler! [ Click to expand ]

Synthetic construct Homo sapiens clone CCSBHm_00010262 INS (INS)
mRNA, encodes complete protein.

1 gttcgttgca acaaattgat gagcaatgct tttttataat gccaactttg tacaaaaaag
61 ttggcatggc cctgtggatg cgcctcctgc ccctgctggc gctgctggcc ctctggggac
121 ctgacccagc cgcagccttt gtgaaccaac acctgtgcgg ctcacacctg gtggaagctc
181 tctacctagt gtgcggggaa cgaggcttct tctacacacc caagacccgc cgggaggcag
241 aggacctgca ggtggggcag gtggagctgg gcgggggccc tggtgcaggc agcctgcagc
301 ccttggccct ggaggggtcc ctgcagaagc gttgcattgt ggaacaatgc tgtaccagca
361 tctgctccct ctaccagctg gagaactact gcaactaccc aactttcttg tacaaagttg
421 gcattataag aaagcattgc ttatcaattt gttgcaacga ac

translation="MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCG
ERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRCIVEQCCTSICSL
YQLENYCN"

Вот задачка - поделить на триплеты,кодирующие проинсулин... :lol: Учитываем,что это комплиментарная последовательность... :flag:
Last Edit: 26 Март 2019 17:47 by hide.

Контексты и комментарии генома 26 Март 2019 15:59 #28

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
GenBank nucleotide sequence database
www.ncbi.nlm.nih.gov/
Last Edit: 26 Март 2019 16:00 by hide.

Контексты и комментарии генома 27 Март 2019 12:18 #29

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Кстати о числе 64...Я тоже о нем подумал где-то неделю назад...Это постиндукция, предвидение или у дураков мысли сходятся? :patstulom:
Есть ассоциации с гексаграммами? Потому как истинно: структура предопределяет свойства... :flag:

I_Ching_Song_Dynasty_print.jpg


Book.png
Last Edit: 27 Март 2019 12:19 by hide.

Контексты и комментарии генома 27 Март 2019 12:55 #30

  • hide
  • hide's Avatar
  • OFFLINE
  • Боярин
  • Fed quod potui, faciant meliora potentes
  • Posts: 1003
  • Thank you received: 1
  • Karma: 1
Еще один момент...Какова вероятность,что на некодирующей (антисмысловой) последовательности ДНК появится Кодирующий пул с промотором? :?
Даже проще...Промотер не нужен. Поскльку АСП аналогична мРНК. Нужна только некодируемая последовательность после...
Last Edit: 27 Март 2019 13:15 by hide.
Рейтинг@Mail.ru

Научно-шахматный клуб КвантоФорум